PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_4AL_B44DF4ACC.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family NAC
Protein Properties Length: 300aa    MW: 33381 Da    PI: 7.2191
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_4AL_B44DF4ACC.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM179.49.2e-5661311128
                    NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk 88 
                            lppGfrFhPtdeel+++yL +kv++ ++ + ++i+++d++k+ePwdLp+k++ +ekewyfFs rd+ky+tg r+nrat+sgyWk+tgk
  Traes_4AL_B44DF4ACC.1   6 LPPGFRFHPTDEELITYYLSRKVSDFSFAT-RAIADADLNKCEPWDLPSKASMGEKEWYFFSMRDRKYPTGIRTNRATESGYWKTTGK 92 
                            79*************************999.88***************999999********************************** PP

                    NAM  89 dkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
                            dke+++ +g+lvg+kktLvfy grapkgekt+Wvmheyr+
  Traes_4AL_B44DF4ACC.1  93 DKEIFH-GGRLVGMKKTLVFYGGRAPKGEKTSWVMHEYRI 131
                            ******.*******************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019417.72E-652152IPR003441NAC domain
PROSITE profilePS5100560.1796152IPR003441NAC domain
PfamPF023652.3E-297131IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 300 aa     Download sequence    Send to blast
MMEEGLPPGF RFHPTDEELI TYYLSRKVSD FSFATRAIAD ADLNKCEPWD LPSKASMGEK  60
EWYFFSMRDR KYPTGIRTNR ATESGYWKTT GKDKEIFHGG RLVGMKKTLV FYGGRAPKGE  120
KTSWVMHEYR IQNKFPYKPN KEEWVVCRVF KKSQIVKMRH PHDSPEMDSP CNEAHASLGE  180
LGEIDVSSML GGFAPAGANA SGDNFGHRID MGAYMNWLAA ANQGAAAMLP WAAAAAPGLL  240
GTVFSANPAM QKALAPFAGC SQLPRDVGGD ALFGNAMAKV DMECEQPPQL EMHESTWRTF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3swm_A1e-56115315169NAC domain-containing protein 19
3swm_B1e-56115315169NAC domain-containing protein 19
3swm_C1e-56115315169NAC domain-containing protein 19
3swm_D1e-56115315169NAC domain-containing protein 19
3swp_A1e-56115315169NAC domain-containing protein 19
3swp_B1e-56115315169NAC domain-containing protein 19
3swp_C1e-56115315169NAC domain-containing protein 19
3swp_D1e-56115315169NAC domain-containing protein 19
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3631710.0AK363171.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2013D22.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003562269.11e-178PREDICTED: protein CUP-SHAPED COTYLEDON 1-like
SwissprotO040172e-77NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
TrEMBLW5DSR30.0W5DSR3_WHEAT; Uncharacterized protein
STRINGMLOC_68284.10.0(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP79193450
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G18400.12e-93NAC domain containing protein 58
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]